PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 300aa    MW: 32809 Da    PI: 9.625
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34922.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.49.6e-16230272547
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                 +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+ 
  KFK34922.1 230 RRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRR 272
                 79***************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-13222273No hitNo description
SMARTSM003381.3E-12226298IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427228273IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-10230275No hitNo description
PfamPF001701.2E-12230273IPR004827Basic-leucine zipper domain
CDDcd147076.35E-23230284No hitNo description
PROSITE patternPS000360233248IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDSQRGLVEE AKSQSLNRQG SMYSLTLDEV QNHLGSSGKA LGSMNLDELL KSVCSVEANH  60
QPMDVNGAAP QEGLSRQGSL TLPRDLSKKT VDEVWKDIQQ NKNGGNAHER RDKQPTLGEM  120
TLEDLLLKAG VVTETIPGSN HDGPGGIPGV GGGGSVGSGA ALGPNMTQVG PWVQYHQLPS  180
MPQPQAFMPY PSSEMQVMVS QSSLMGGLSD TQTPGRKRAS GEIVEKTVER RQKRMIKNRE  240
SAARSRARKQ AYTHELEIKV SRLEEENERL RRQKEVEKIL PSAPPPDPKR QLRRTSSAPF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0171621e-161AB017162.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 3 (AREB3), complete cds.
GenBankAY0624481e-161AY062448.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850; T8M16_180) mRNA, complete cds.
GenBankAY0816701e-161AY081670.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010504594.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES30.0AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A087GYH00.0A0A087GYH0_ARAAL; Uncharacterized protein
STRINGAT3G56850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-168ABA-responsive element binding protein 3